| Bioactivity | (Glu20)-Amyloid β-Protein (1-42) is a slower fibrillizing variant of amyloid β-protein (Aβ). The Glu20 mutation reduces the aggregation propensity of Aβ42 and prevents accumulation of the slowly fibrillizing peptide. Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease[1][2]. |
| Name | (Glu20)-Amyloid β-Protein (1-42) |
| CAS | 1802086-22-1 |
| Shortening | DAEFRHDSGYEVHHQKLVFEAEDVGSNKGAIIGLMVGGVVIA |
| Formula | C199H309N55O62S |
| Molar Mass | 4495.98 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
(Glu20)-Amyloid β-Protein (1-42)
CAS: 1802086-22-1 F: C199H309N55O62S W: 4495.98
(Glu20)-Amyloid β-Protein (1-42) is a slower fibrillizing variant of amyloid β-protein (Aβ). The Glu20 mutation reduc
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.