| Bioactivity | (Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism[1]. |
| Name | (Glu17,21,24)-Osteocalcin (1-49) (human) |
| CAS | 1927927-11-4 |
| Sequence | Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val (Disulfide bridge: Cys23-Cys29) |
| Shortening | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge: Cys23-Cys29) |
| Formula | C266H381N67O76S2 |
| Molar Mass | 5797.40 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
(Glu17,21,24)-Osteocalcin (1-49) (human)
CAS: 1927927-11-4 F: C266H381N67O76S2 W: 5797.40
(Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.