| Bioactivity | (Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism[1]. |
| Name | (Glu13,17,20)-Osteocalcin (1-46) (mouse) |
| CAS | 1802086-27-6 |
| Sequence | Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile (Disulfide bridge: Cys19-Cys25) |
| Shortening | YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI (Disulfide bridge: Cys19-Cys25) |
| Formula | C226H351N57O74S2 |
| Molar Mass | 5114.67 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
(Glu13,17,20)-Osteocalcin (1-46) (mouse)
CAS: 1802086-27-6 F: C226H351N57O74S2 W: 5114.67
(Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specif
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.