| Bioactivity | (Gln22,Asn23)-Amyloid β-Protein (1-40) is a peptide. (Gln22,Asn23)-Amyloid β-Protein (1-40) can be used for the research of Cerebral Amyloid Angiopathy Mutations[1]. |
| Name | (Gln22,Asn23)-Amyloid β-Protein (1-40) |
| CAS | 374796-75-5 |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asn-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Shortening | DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV |
| Formula | C194H297N55O56S |
| Molar Mass | 4327.83 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Van Nostrand WE, et al. Pathogenic effects of cerebral amyloid angiopathy mutations in the amyloid beta-protein precursor. Ann N Y Acad Sci. 2002 Nov;977:258-65. |