| Bioactivity | (Gln22)β-Amyloid (1-40) human is an amyloid beta protein (Aβ)-containing peptide used in Alzheimer's disease research[1]. |
| Name | (Gln22)β-Amyloid (1-40) human |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Shortening | DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV |
| Formula | C194H296N54O57S |
| Molar Mass | 4328.82 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Kirkitadze MD, et al. Identification and characterization of key kinetic intermediates in amyloid beta-protein fibrillogenesis. J Mol Biol. 2001 Oct 5;312(5):1103-19. |
(Gln22)β-Amyloid (1-40) human
CAS: F: C194H296N54O57S W: 4328.82
(Gln22)β-Amyloid (1-40) human is an amyloid beta protein (Aβ)-containing peptide used in Alzheimer's disease research.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.