| Bioactivity | (D-Asp1)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease[1]. |
| Name | (D-Asp1)-Amyloid β-Protein (1-42) |
| CAS | 1802086-19-6 |
| Shortening | {d-Asp}-EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Formula | C203H311N55O60S |
| Molar Mass | 4514.04 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Poduslo JF, Curran GL, Sanyal B, Selkoe DJ. Receptor-mediated transport of human amyloid beta-protein 1-40 and 1-42 at the blood-brain barrier. Neurobiol Dis. 1999 Jun;6(3):190-9. |
(D-Asp1)-Amyloid β-Protein (1-42)
CAS: 1802086-19-6 F: C203H311N55O60S W: 4514.04
(D-Asp1)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.