| Bioactivity | (Asp37)-Amyloid β-Protein (1-42) is the G37D mutant of wild-type Amyloid-beta (1-42) peptide[1]. |
| Name | (Asp37)-Amyloid β-Protein (1-42) |
| CAS | 1875128-79-2 |
| Sequence | Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Asp-Gly-Val-Val-Ile-Ala |
| Shortening | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVDGVVIA |
| Formula | C205H313N55O62S |
| Molar Mass | 4572.08 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Louise Charlotte SERPELL, et al. Alzheimer's disease. WO2016020661A1. |
(Asp37)-Amyloid β-Protein (1-42)
CAS: 1875128-79-2 F: C205H313N55O62S W: 4572.08
(Asp37)-Amyloid β-Protein (1-42) is the G37D mutant of wild-type Amyloid-beta (1-42) peptide.
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.