| CAS | 40077-57-4 |
| Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
| Sequence Single | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Molecular Formula | C147H238N44O42S |
| Molecular Weight | 3325.84 |
| Synonyms | Aviptadil, VIP, human, porcine, rat, ovine |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases|Gastrointestinal Research |
| Description | VIP (human, mouse, rat) also called Aviptadil, VIP, human, porcine, rat, ovine, a 28-amino acid peptide belonging to the secretin-glucagon-CRF family, is widely distributed in the central and peripheral nervous systems. VIP (human, mouse, rat) has potent vasodilatory effects. VIP (human, mouse, rat) induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. VIP (human, mouse, rat) can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al. |
| References | 1. N-(fluorenyl-9-methoxycarbonyl) amino acids, a class of antiinflammatory agents with a different mechanism of action. R.M.Burch et al., Proc. Natl. Acad. Sci. USA, 88, 355 (1991) 2. Vasoactive intestinal peptide. Messenger in a neuroimmune axis. G.D.Wenger et al., Ann. N. Y. Acad. Sci., 594, 104 (1990) 3. The discovery of VIP: initially looked for in the lung, isolated from intestine, and identified as a neuropeptide. W.I.Said et al., Peptides, 28, 1620 (2007) 4. Liposomal vasoactive intestinal peptide. V.Sethi et al., Meth. Enzymol., 391, 377 (2005) 5. VIP as a modulator of lung inflammation and airway constriction. S.I.Said, Am. Rev. Respir. Dis., 143, S22 (1991) 6. Vasoactive intestinal peptide as a new drug for treatment of primary pulmonary hypertension. V.Petkov et al., J. Clin. Invest., 111, 1339 (2003) 7. Aviptadil (Senatek). G.B.Keijzers, Curr Opin Investig Drugs , 2, 545 (2001) 8. VIP: molecular biology and neurobiological function. I.Gozes and D.E.Brenneman, Mol. Neurobiol., 3, 201 (1989) 9. Generation and recognition of vasoactive intestinal peptide by cells of the immune system. E.J.Goetzl et al., Ann. N. Y. Acad. Sci., 594, 34 (1990) 10. Novel Targets of Drug Treatment for Pulmonary Hypertension. Jian Hu, et al. Am J Cardiovasc Drugs. |