| CAS | 96886-24-7 |
| Sequence | H-His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2 |
| Sequence Single | HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 |
| Molecular Formula | C147H239N43O42S2 |
| Molecular Weight | 3344.91 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | VIP (guinea pig)(Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function. |
| References | 1. Vasoactive intestinal peptide shortens both G1 and S phases of neural cell cycle in whole postimplantation cultured mouse embryos. P Gressens, et al. Eur J Neurosci. 1998 May;10(5):1734-42. 2. Possible dual role for vasoactive intestinal peptide as gastrointestinal hormone and neurotransmitter substance. M G Bryant, et al. Lancet. 1976 May 8;1(7967):991-3. |