| CAS | 291524-04-4 |
| Sequence | H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH2 |
| Sequence Single | HSDAVFTDNYARLRKQMAVKKALNSILA-NH2 |
| Molecular Formula | C139H231N43O39S |
| Molecular Weight | 3160.7 |
| Synonyms | (Ala11.22.28)-Aviptadil |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | (Ala11.22.28)-VIP (human, mouse, rat) also called (Ala11.22.28)-Aviptadil, is a highly selective human VPAC1 receptor agonist. It showed a 1000-fold higher efficiency in stimulating adenylate cyclase activity from VPAC1 than from VPAC2 receptors and therefore represents an effective pharmacological tool to characterize VPAC1 receptor-mediated events. |
(Ala11.22.28)-VIP (human, mouse, rat)
CAS No.: 291524-04-4
(Ala11.22.28)-VIP (human, mouse, rat) also called (Ala11.22.28)-Aviptadil, is a highly selective human VPAC1 recept
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.