| CAS | 87403-73-4 |
| Sequence | H-His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2 |
| Sequence Single | HADGVFTSDFSKLLGQLSAKKYLESLM-NH2 |
| Molecular Formula | C135H214N34O40S |
| Molecular Weight | 2985.46 |
| Synonyms | PHM-27/PHI, human |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | PHM-27 (human) also called PHM-27/PHI, human, is a human prepro-vasoactive intestinal polypeptide (27 amino acid). PHM-27 (human) is a potent the human calcitonin receptor agonist with an EC50 of 11 nM. PHM-27 (human) efficiently enhances glucose-induced insulin secretion from beta cells by an autocrine mechanism. |
| References | 1. Human preprovasoactive intestinal polypeptide contains a novel PHI-27-like peptide, PHM-27. Itoh et al (1983). Nature 304 547 PMID: 6571696 2. Transgenic mice overexpressing human vasoactive intestinal peptide (VIP) gene in pancreatic β cells. Kato et al (1994). J.Biol.Chem. 269 21223 PMID: 8063743 3. Discovery of novel peptide/receptor interactions: identification of PHM-27 as a potent agonist of the human calcitonin receptor. Ma et al (2004). Biochem.Pharmacol. 67 1279 PMID: 15013843 |