| CAS | 83930-33-0 |
| Sequence | H-Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 |
| Sequence Single | NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 |
| Molecular Formula | C210H340N62O67S2 |
| Molecular Weight | 4869.52 |
| Synonyms | Catostomus urotensin I |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases |
| Description | Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively. |
| References | 1. Characterisation using microphysiometry of CRF receptor pharmacology. Smart D, et al. Eur J Pharmacol. 1999 Aug 27;379(2-3):229-35. 2. Corticotropin-releasing factor receptors 1 and 2 in anxiety and depression. Reul JM, et al. Curr Opin Pharmacol. 2002 Feb;2(1):23-33. 3. Urotensin I, a CRF-like neuropeptide, stimulates acth release from the teleost pituitary. Fryer J, et al. Endocrinology. 1983;113(6):2308-2310. 4. Urotensin I effects on intracellular content of cyclic AMP in the rat tail artery. Gerritsen ME, et al. Eur J Pharmacol. 1979;60(2-3):211-220. |