| CAS | 357952-10-4 |
| Sequence | H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 |
| Sequence Single | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 |
| Molecular Formula | C186H312N52O52S2 |
| Molecular Weight | 4172.97 |
| Synonyms | SCP (3-40) (mouse), Stresscopin (3-40) (mouse), Ucn III (mouse) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Urocortin III (mouse) also called SCP (3-40) (mouse), Stresscopin (3-40) (mouse), Ucn III (mouse), is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics. |
| References | 1. The total chemical synthesis of monocyte chemotactic protein-1 (MCP-1). A.R.Brown et al., J. Pept. Sci., 2, 40 (1996) 2. Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Lewis K, et al. 3. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Shemesh Y, et al. Nat Neurosci. 2016 Nov;19(11):1489-1496. |