| CAS | 357952-09-1 |
| Sequence | H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 |
| Sequence Single | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
| Molecular Formula | C185H307N53O50S2 |
| Molecular Weight | 4137.93 |
| Synonyms | Stresscopin (3-40) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Urocortin III (human) also called Stresscopin (3-40) (human), is a highly selective ligand for the CRF-II receptor. The amino acid sequence of Urocortin III (human) corresponds to amino acids 3-40 of stresscopin (human). |
| References | 1. N-Methyl scan of somatostatin octapeptide agonists produces interesting effects on receptor subtype specificity. W.G.Rajeswaran et al., J. Med. Chem., 44, 1416 (2001) |