| CAS | 330648-32-3 |
| Sequence | H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2 |
| Sequence Single | VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 |
| Molecular Formula | C187H320N56O50 |
| Molecular Weight | 4152.95 |
| Synonyms | Ucn II (mouse) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Urocortin II (mouse) also called Ucn II (mouse), exhibited considerably higher affinity for both splice variants of the type 2 CRF receptor (CRF-R2) than for CRF-R1. The potencies of Urocortin II (mouse) in activating CRF-R2α and CRF-R2β were nearly equivalent to that of urocortin (rat). |
| References | 1. Identification of neuromedin S and its possible role in the mammalian circadian oscillator system. K.Mori et al., EMBO J., 24, 325 (2005) 2. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. K.Lewis et al., Proc. Natl. Acad. Sci. USA, 98, 7570 (2001) 3. Urocortin II: a member of the corticotropin-releasing factor (CRF) neuropeptide family that is selectively bound by type 2 CRF receptors. T.M.Reyes et al., Proc. Natl. Acad. Sci. USA, 98, 2843 (2001) |