| CAS | 213779-11-4 |
| Sequence | H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH |
| Sequence Single | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY |
| Molecular Formula | C194H303N59O53 |
| Molecular Weight | 4309.91 |
| Synonyms | (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat), (Tyr36)-pTHrP (1-36) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research |
| Description | (Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) also called (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat), (Tyr36)-pTHrP (1-36), has been used for radioiodination. |
| References | 1. Parathyroid hormone-related protein purified from a human lung cancer cell line. J.M.Moseley et al., Proc. Natl. Acad. Sci. USA, 84, 5048 (1987) 2. Expression and signaling of parathyroid hormone-related protein in cultured podocytes. N.Endlich et al., Exp. Nephrol., 9, 436 (2001) |
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat)
CAS No.: 213779-11-4
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) also called (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) (hu
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.