| CAS | 152617-91-9 |
| Sequence | H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Ile-Phe-Leu-Gln-Asn-Leu-Ile-Glu-Gly-Val-Asn-Thr-Ala-Glu-Tyr-NH2 |
| Sequence Single | AVSEHQLLHDKGKSIQDLRRRIFLQNLIEGVNTAEY-NH2 |
| Molecular Formula | C184H301N57O55 |
| Molecular Weight | 4191.76 |
| Synonyms | (Tyr36)-pTHrp (1-36) amide (chicken), (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) amide (chicken), PTHrP (1-36) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | (Tyr36)-pTH-Related Protein (1-36) amide (chicken) also called (Tyr36)-pTHrp (1-36) amide (chicken), (Tyr36)-Hypercalcemia of Malignancy Factor (1-36) amide (chicken), PTHrP (1-36). Zhao et al. observed that treatment with chicken PTHrP (1-36) stimulated differentiation of both chondrogenic and osteogenic cells in cultures of mandibular mesenchymal cells. |