| CAS | 86292-93-5 |
| Sequence | H-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Tyr-NH2 |
| Sequence Single | FMHNLGKHLSSMERVEWLRKKLQDVHNY-NH2 |
| Molecular Formula | C156H244N48O40S2 |
| Molecular Weight | 3496.08 |
| Synonyms | [Tyr34] Parathyroid Hormone (7-34), amide, bovine |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | (Tyr34)-pTH (7-34) amide (bovine) also called [Tyr34] Parathyroid Hormone (7-34), amide, bovine, is an inhibitor of pTH action in vivo. |
| References | 1. Parathyroid hormone (1-84) and treatment of osteoporosis. S.P.Shrader and K.R.Ragucci, Ann. Pharmacother., 39, 1511 (2005) |
(Tyr34)-pTH (7-34) amide (bovine)
CAS No.: 86292-93-5
(Tyr34)-pTH (7-34) amide (bovine) also called [Tyr34] Parathyroid Hormone (7-34), amide, bovine, is an inhibitor of pTH
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.