| CAS | 153238-99-4 |
| Sequence | H-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-OH |
| Sequence Single | MERVEWLRKKLQDVHNFVALGAPLAPRDAGS |
| Molecular Formula | C156H251N47O43S |
| Molecular Weight | 3505.07 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research |
| Description | pTH (18-48) (human) is a pTH fragment. In bone-derived assay systems pTH (18-48) (human) retains the ability to induce cell proliferation and exhibits partial agonist activity in the adenylyl cyclase/protein kinase A signal transduction pathway. It is the most N-terminally truncated pTH fragment having such characteristics. |