| CAS | 330456-24-1 |
| Sequence | H-Gln-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH |
| Sequence Single | QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK |
| Molecular Formula | C141H238N42O44S |
| Molecular Weight | 3257.63 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Tau Peptides |
| Description | During heparin-induced self-aggregation of the four repeat domain peptides (R1–R4) excised from tau, R1, which resembles Tau Peptide (244-274), was the most resistive to filament formation. Its conformation remained unchanged. The peptide maintained the same random structure under both acidic and neutral conditions. |
| References | 1. Dual modification of Alzheimer’s disease PHF-tau protein by lysine methylation and ubiquitylation: a mass spectrometry approach. S.N.Thomas et al., Acta Neuropathol., 123, 105 (2012) |
Tau Peptide (244-274) (Repeat 1 Domain)
CAS No.: 330456-24-1
During heparin-induced self-aggregation of the four repeat domain peptides (R1–R4) excised from tau, R1, which resemble
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.