| CAS | 1428134-39-7 |
| Sequence | H-Thr-Ala-Pro-Val-Pro-Met-Pro-Asp-Leu-Lys-Asn-Val-Lys-Ser-Lys-Ile-Gly-Ser-Thr-Glu-Asn-Leu-Lys-His-Gln-Pro-Gly-Gly-Gly-Lys-OH |
| Sequence Single | TAPVPMPDLKNVKSKIGSTENLKHQPGGGK |
| Molecular Formula | C136H230N40O42S |
| Molecular Weight | 3129.63 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Tau Peptides |
| Description | Tau Peptide (245-274) (Repeat 1 Domain) is the sequence adjacent to the aggregating PHF6* motif (VQIINK). In PHF-tau, N-methylation of Lys254 and Lys267 and phosphorylation of Ser262 was detected. If not methylated, Lys254 is an ubiquitinylation site. |
| References | 1. Dual modification of Alzheimer’s disease PHF-tau protein by lysine methylation and ubiquitylation: a mass spectrometry approach. P.Delobel et al., Am. J. Pathol., 172, 132 (2008) |
Tau Peptide (245-274) (Repeat 1 Domain)
CAS No.: 1428134-39-7
Tau Peptide (245-274) (Repeat 1 Domain) is the sequence adjacent to the aggregating PHF6* motif (VQIINK). In PHF-tau, N-
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.