| CAS | 352020-03-2 |
| Sequence | H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 |
| Sequence Single | TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
| Molecular Formula | C195H326N56O53S2 |
| Molecular Weight | 4367.21 |
| Synonyms | SCP (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Stresscopin (human) also called SCP (human), is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2). Transcripts are expressed in brain and most tissues analyzed. Intraperitoneal injections of stresscopin suppresses heat-induced edema formation in anesthetized rats. It also decreases food intake and exhibits an inhibitory effect on gastric emptying activity. Stresscopin (human) might represent an endogenous ligand for maintaining homeostasis after stress. |
| References | 1. AXOR12, a novel human G protein-coupled receptor, activated by the peptide KiSS-1. A.I.Muir et al., J. Biol. Chem., 276, 28969 (2001) |