| CAS | 203460-30-4 |
| Sequence | H-Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp-OH(Disulfide bridge between 7 - 21, 14 - 26, 20 - 33) |
| Sequence Single | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD(Disulfide bridge between 7 - 21, 14 - 26, 20 - 33) |
| Molecular Formula | C192H274N52O60S7 |
| Molecular Weight | 4495.01 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | SNX 482 is a potent and selective, voltage-dependent R-type CaV2.3 calcium channel blocker (IC50 = 30 nM). Antinociceptive; inhibits nociceptive C-fibre and Aδ-fibre-evoked neuronal responses. |
| References | 1. Selective peptide antagonist of the class E calcium channel from the venom of the Tarantula Hysterocrates gigas. Newcomb et al (1998). Biochemistry 37 15353 PMID: 9799496 2. Interaction of SNX482 with domains III and IV inhibits activation gating of α1E (CaV2.3) calcium channels. Bourinet et al (2001). Biophys.J. 81 79 PMID: 11423396 3. The CaV2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Matthews et al (2007). Eur.J.Neurosci. 25 3561 PMID: 17610575 |