| CAS | 158484-42-5 |
| Sequence | H-Glu-Asp-Asn-Cys-Ile-Ala-Glu-Asp-Tyr-Gly-Lys-Cys-Thr-Trp-Gly-Gly-Thr-Lys-Cys-Cys-Arg-Gly-Arg-Pro-Cys-Arg-Cys-Ser-Met-Ile-Gly-Thr-Asn-Cys-Glu-Cys-Thr-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Ser-Phe-Ala-OH(Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34) |
| Sequence Single | EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bridge between 4 - 20, 12 - 25, 19 - 36, 27 - 34) |
| Molecular Formula | C215H337N65O70S10 |
| Molecular Weight | 5273.02 |
| Synonyms | Agatoxin IVB |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | ω-Agatoxin TK also called Agatoxin IVB, is a selective blocker of CaV2.1 P/Q-type calcium channels. |
| References | 1. A novel type of calcium channel sensitive to ω-agatoxin-TK in cultured rat cerebral cortical neurons. Teramoto et al (1997). Brain Res. 756 225 PMID: 9187336 2. High-affinity inhibition of glutamate release from corticostriatal synapses by ω-agatoxin TK. Barral et al (2001). Eur.J.Pharmacol. 430 167 PMID: 11711028 3. A novel peptide from funnel web spider venom, ω-Aga-TK, selectively blocks P-type calcium channels. Teramoto et al (1993). Biochem.Biophys.Res.Comms. 196 134 |