| CAS | 154765-04-5 |
| Sequence | H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-OH |
| Sequence Single | VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG |
| Molecular Formula | C194H314N58O53S2 |
| Molecular Weight | 4371.12 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research |
| Description | pTH (2-38) (human) is the analog of hPTH(1-38) removal of the N-terminal serine, it diminishes the anabolic effect of hPTH(1-38). |
| References | 1. Amyloid beta protein enhances the survival of hippocampal neurons in vitro. J.S.Whitson et al., Science, 243, 1488 (1989) |