| CAS | 51257-86-4 |
| Sequence | H-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence Single | SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
| Molecular Formula | C175H274N52O48S2 |
| Molecular Weight | 3938.55 |
| Synonyms | Parathyroid Hormone (3-34), bovine |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | pTH (3-34) (bovine) also called Parathyroid Hormone (3-34), bovine. In vitro experiments have shown that pTH (3-34) inhibits the stimulation of adenylate cyclase by pTH (1-34), but has no agonist or antagonistic effects on renal phosphate transport in vivo. |
| References | 1. A parathyroid hormone inhibitor in vivo: design and biological evaluation of a hormone analog. N.Horiuchi et al., Science, 220, 1053 (1983) 2. Parathyroid hormone: effects of the 3-34 fragment in vivo and vitro. J.A.McGowan et al., Science, 219, 67 (1983) |