| CAS | 247902-18-7 |
| Sequence | H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence Single | VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Molecular Formula | C178H286N54O49S2 |
| Molecular Weight | 4030.7 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases|Osteoporosis Research |
| Description | pTH (2-34) (human) is a impurity of teriparatide produced during the chemical synthesis and a potential metabolite. The N-terminally truncated sequence pTH (2-34) (human) showed a reduced potency in stimulating bone formation. Like pTH (1-34), pTH (2-34) decreased coronary perfusion pressure in isolated rat hearts but in contrast to pTH (1-34) it had no effect on heart rate. |
| References | 1. A Synthesis of Human Proinsulin C-Peptide. K.Igano et al., Bull. Chem. Soc. Jpn., 54, 3088 (1981) 2. Ligand-selective dissociation of activation and internalization of the parathyroid hormone (PTH) receptor: conditional efficacy of PTH peptide fragments. W.B.Sneddon et al., Endocrinology, 145, 2815 (2004) |