| CAS | 136799-54-7 |
| Sequence | H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-OH |
| Sequence Single | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL |
| Molecular Formula | C195H316N58O54S2 |
| Molecular Weight | 4401.15 |
| Synonyms | Parathyroid Hormone (1-37) (human), Parathyrin (1-37) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research |
| Description | pTH (1-37) (human) also called Parathyroid Hormone (1-37) (human), Parathyrin (1-37) (human), is supposed to be the native bioactive fragment of pTH (1-84) (human) in circulation. Furthermore it was shown that pulsatile but not continuous administration of pTH (1-37) (human) increased growth, bone calcium content, and bone mineral density in uremic animals. |
| References | 1. beta-Thymosins, small acidic peptides with multiple functions. T.Huff et al., Int. J. Biochem. Cell Biol., 33, 205 (2001) |