| CAS | 98614-76-7 |
| Sequence | H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Sequence Single | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
| Molecular Formula | C180H291N55O48S2 |
| Molecular Weight | 4057.76 |
| Synonyms | Parathyroid Hormone (1-34), rat |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Osteoporosis Research|Regenerative Medicine |
| Description | pTH (1-34) (rat) also called Parathyroid Hormone (1-34), rat, is a parathyroid hormone. pTH (1-34) (rat) improves both cortical and cancellous bone structure. pTH (1-34) (rat) can be used for the research of osteoporosis. |
| References | 1. A proteolytic system that compensates for loss of proteasome function. R.Glas et al., Nature, 392, 618 (1998) 2. Biologic activities of parathyroid hormone (1-34) and parathyroid hormone-related peptide (1-34) in isolated perfused rat femur. S.Lopez-Hilker et al., J. Lab. Clin. Med., 119, 738 (1992) 3. Loss of cancellous bone mass and connectivity in ovariectomized rats can be restored by combined treatment with parathyroid hormone and estradiol. V Shen, et al. J Clin Invest. 1993 Jun;91(6):2479-87. 4. Recombinant human parathyroid hormone (1-34) [teriparatide] improves both cortical and cancellous bone structure. Yebin Jiang, et al. J Bone Miner Res. 2003 Nov;18(11):1932-41. |