PeptideDB

pTH (1-34) (human)

CAS No.: 52232-67-4

pTH (1-34) (human) also called Teriparatide, Parathyroid Hormone (1-34), human, is a PHT agonist. It consists of the N-t
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 52232-67-4
Sequence H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Sequence Single SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Molecular Formula C181H291N55O51S2
Molecular Weight 4117.77
Synonyms Teriparatide, Parathyroid Hormone (1-34), human
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Osteoporosis Research|Regenerative Medicine|Veterinary Medicine
Description pTH (1-34) (human) also called Teriparatide, Parathyroid Hormone (1-34), human, is a PHT agonist. It consists of the N-terminal 34 amino acid residues of parathyroid hormone, shows the same potency and pharmacological profile as the native hormone. Administration of teriparatide stimulates bone formation and increases the bone mineral density (BMD). pTH (1-34) (human) can be used for osteoporosis research.
References 1.  Effects of parathyroid hormone on newly regenerated bone during distraction osteogenesis in a rabbit tibial lengthening model. A pilot study. R.Aleksyniene et al., Medicina (Kaunas), 42, 38 (2006) 2.  Teriparatide and osseous regeneration in the oral cavity. J.D.Bashutski et al., N. Engl. J. Med., 363, 2396 (2010) 3.  Treatment of osteoporosis with human parathyroid peptide and observations on effect of sodium fluoride. J.Reeve et al., Br. Med. J., 301, 314 (1990) 4.  Anabolic actions of PTH (1-34): use of a novel tissue engineering model to investigate temporal effects on bone. G.J.Pettway et al., Bone, 36, 959 (2005) 5.  Effects of two treatment regimes with synthetic human parathyroid hormone fragment on bone formation and the tissue balance of trabecular bone in greyhounds. R.Podbesek et al., Endocrinology, 112, 1000 (1983) 6.  Structure and protein kinase C stimulating activities of lactam analogues of human parathyroid hormone fragment. W.Neugebauer et al., Int. J. Pept. Protein Res., 43, 555 (1994) 7.  Synthetic peptides as tools for investigating the pathogenicity of disease: humoral hypercalcemia of malignancy. R.L.McKee and M.P.Caulfield, Pept. Res., 2, 161 (1989) M Takigawa, et al. 8.  Two-dimensional 1H-NMR study of the 1-34 fragment of human parathyroid hormone. S.C.Lee and A.F.Russell, Biopolymers, 28, 1115 (1989) 9.  Human parathyroid hormone (1-34) accelerates the fracture healing process of woven to lamellar bone replacement and new cortical shell formation in rat femora. S.Komatsubara et al., Bone, 36, 678 (2005) 10.  Pharmacokinetics of synthetic human parathyroid hormone 1-34 in man measured by cytochemical bioassay and radioimmunoassay. G.N.Kent et al., Clin. Sci., 68, 171 (1985) 11.  Influence of Teriparatide and Ibandronate on Cortical Bone in New Zealand White Rabbits: A HR-QCT Study. Iwamoto J, et, al. Calcif Tissue Int. 2016.