| CAS | 484598-35-8 |
| Sequence | H-Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Ala-Gly-Gln-Thr-Cys-Cys-Lys-His-Leu-Val-Cys-Ser-Arg-Arg-His-Gly-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH(Disulfide bridge: 2-16, 9-21, 15-28) |
| Sequence Single | ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS(Disulfide bridge: 2-16, 9-21, 15-28) |
| Molecular Formula | C171H245N53O47S6 |
| Molecular Weight | 3987.51 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | ProTx I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na+ channels and inhibits KV 2.1 channels. |
| References | 1. Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ channels Cav3.1 and Cav3.2. Ohkubo et al (2010). J.Pharmacol.Sci. 112 452 PMID: 20351484 2. T-type voltage-activated calcium channel Cav3.1, but not Cav3.2, is involved in the inhibition of proliferation and apoptosis in MCF-7 human breast cancer cells. Ohkubo and Yamazaki (2012). Int.J.Oncol. 41 267 PMID: 22469755 3. Two tarantula peptides inhibit activation of multiple sodium channels. Middleton et al (2002). Biochemistry 41 14734 PMID: 12475222 |