PeptideDB

ProTx I

CAS No.: 484598-35-8

ProTx I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 va
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 484598-35-8
Sequence H-Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Ala-Gly-Gln-Thr-Cys-Cys-Lys-His-Leu-Val-Cys-Ser-Arg-Arg-His-Gly-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH(Disulfide bridge: 2-16, 9-21, 15-28)
Sequence Single ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS(Disulfide bridge: 2-16, 9-21, 15-28)
Molecular Formula C171H245N53O47S6
Molecular Weight 3987.51
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Description ProTx I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na+ channels and inhibits KV 2.1 channels.
References 1.  Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ channels Cav3.1 and Cav3.2. Ohkubo et al (2010). J.Pharmacol.Sci. 112 452 PMID: 20351484 2.  T-type voltage-activated calcium channel Cav3.1, but not Cav3.2, is involved in the inhibition of proliferation and apoptosis in MCF-7 human breast cancer cells. Ohkubo and Yamazaki (2012). Int.J.Oncol. 41 267 PMID: 22469755 3.  Two tarantula peptides inhibit activation of multiple sodium channels. Middleton et al (2002). Biochemistry 41 14734 PMID: 12475222