| CAS | 573671-91-7 |
| Sequence | H-Asp-Met-Tyr-Glu-Ile-Lys-Gln-Tyr-Lys-Thr-Ala-His-Gly-Arg-Pro-Pro-Ile-Cys-Ala-Pro-Gly-Glu-Gln-Cys-Pro-Ile-Trp-Val-NH2(Disulfide bridge between 18 - 24) |
| Sequence Single | DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH2(Disulfide bridge between 18 - 24) |
| Molecular Formula | C145H219N39O39S3 |
| Molecular Weight | 3228.75 |
| Synonyms | Bombinakinin M Gene Associated Peptide |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | Bombinakinin-GAP also called Bombinakinin M Gene Associated Peptide, is a bioactive bradykinin-related peptide. Bombinakinin-GAP induces a 60% reduction in food intake following i.c.v. administration in rats. |
| References | 1. Bombinakinin M gene associated peptide, a novel bioactive peptide from skin secretions of the toad Bombina maxima. Lai et al (2003). Peptides 24 199 PMID: 12668203 |