| CAS | 894454-10-5 |
| Sequence | H-Phe-Leu-Phe-His-Tyr-Ser-Arg-Thr-Gln-Glu-Ala-Thr-His-Pro-Val-Lys-Thr-Gly-Phe-Pro-Pro-Val-His-Pro-Leu-Met-His-Leu-Ala-Ala-Lys-Leu-Ala-Asn-OH |
| Sequence Single | FLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLAN |
| Molecular Formula | C180H271N49O44S |
| Molecular Weight | 3857.5 |
| Synonyms | Prepro-NMS (70-103) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Pituitary & Hypothalamic Hormones |
| Description | Prepro-Neuromedin S (70-103) (human) also called Prepro-NMS (70-103) (human), it shows potent prolactin-releasing activity in rats by preliminary experiments. |
Prepro-Neuromedin S (70-103) (human)
CAS No.: 894454-10-5
Prepro-Neuromedin S (70-103) (human) also called Prepro-NMS (70-103) (human), it shows potent prolactin-releasing activi
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.