| CAS | 1138204-27-9 |
| Sequence | H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 |
| Sequence Single | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2 |
| Molecular Formula | C173H265N53O44 |
| Molecular Weight | 3791.34 |
| Synonyms | NMS (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Obesity Research |
| Description | Neuromedin S (human) also called NMS (human), is a 33-amino acid neuropeptide originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. Neuromedin S (human) is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that Neuromedin S is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions. |
| References | 1. Reciprocal regulation of angiotensin receptor-activated extracellular signal-regulated kinases by beta-arrestins 1 and 2. S.Ahn et al., J. Biol. Chem., 279, 7807 (2004) |