PeptideDB

Neuromedin S (human)

CAS No.: 1138204-27-9

Neuromedin S (human) also called NMS (human), is a 33-amino acid neuropeptide originally isolated from rat brain as an e
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 1138204-27-9
Sequence H-Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2
Sequence Single ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
Molecular Formula C173H265N53O44
Molecular Weight 3791.34
Synonyms NMS (human)
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Obesity Research
Description Neuromedin S (human) also called NMS (human), is a 33-amino acid neuropeptide originally isolated from rat brain as an endogenous ligand for two orphan G protein-coupled receptors FM-3/GPR66 and FM-4/TGR-1, which have been identified as neuromedin U (NMU) receptors. Neuromedin S (human) is specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. It has been shown that Neuromedin S is implicated in the regulation of circadian rhythms through autocrine and/or paracrine actions.
References 1.  Reciprocal regulation of angiotensin receptor-activated extracellular signal-regulated kinases by beta-arrestins 1 and 2. S.Ahn et al., J. Biol. Chem., 279, 7807 (2004)