| CAS | 137061-48-4 |
| Sequence | H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
| Sequence Single | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
| Molecular Formula | C203H331N63O53S |
| Molecular Weight | 4534.33 |
| Synonyms | Pituitary Adenylate Cyclase-Activating Polypeptide 1-38 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | PACAP 1-38 also called Pituitary Adenylate Cyclase-Activating Polypeptide 1-38, is a neuropeptide with 38 amino acid residues. PACAP 1-38 binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. |
| References | 1. The 38-amino-acid form of pituitary adenylate cyclase-activating polypeptide induces neurite outgrowth in PC12 cells that is dependent on protein kinase C and extracellular signal-regulated kinase but not on protein kinase A, nerve growth factor receptor Lazarovici et al (1998). Mol. Pharmacol. 54 547 PMID: 9730914 2. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Michel et al (1998) XVI. Pharmacol. Rev. 50 143 PMID: 9549761 3. Pituitary adenylate cyclase-activating polypeptide increase [Ca2+]i in rat gonadotrophs through an inositol trisphosphate-dependent mechanism. Rawlings et al (1994). J.Biol.Chem. 269 5680 PMID: 7907085 4. Fragments of pituitary adenylate cyclase activating polypeptide discriminate between type I and II recombinant receptors. Gourlet P, et al. Eur J Pharmacol. 1995 Dec 4;287(1):7-11. 5. Pituitary adenylate cyclase activating polypeptide enhances glucose-evoked insulin secretion in the canine pancreas in vivo. Yamaguchi N. JOP. 2001 Sep;2(5):306-16. 6. Inhibition of bronchoconstriction by pituitary adenylate cyclase activating polypeptide (PACAP 1-27) in guinea-pigs in vivo. Lindén A, et al. Br J Pharmacol. 1995 Jul;115(6):913-6. 7. Passage through the Ocular Barriers and Beneficial Effects in Retinal Ischemia of Topical Application of PACAP (1-38) in Rodents. Werling D, et al. Int J Mol Sci. 2017 Mar 21;18(3). pii: E675. |