| CAS | 145017-83-0 |
| Sequence | H-Lys-Lys-Lys-Cys-Ile-Ala-Lys-Asp-Tyr-Gly-Arg-Cys-Lys-Trp-Gly-Gly-Thr-Pro-Cys-Cys-Arg-Gly-Arg-Gly-Cys-Ile-Cys-Ser-Ile-Met-Gly-Thr-Asn-Cys-Glu-Cys-Lys-Pro-Arg-Leu-Ile-Met-Glu-Gly-Leu-Gly-Leu-Ala-OH (Disulfide bonds between Cys4 and Cys20/Cys12 and Cys25/Cys19 and Cys36/Cys27 and Cys34) |
| Sequence Single | KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA |
| Molecular Formula | C217H360N68O60S10 |
| Molecular Weight | 5202.33 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Ion Channel Modulating Agents |
| Description | ω-Agatoxin IVa is a peptide isolated from the venom of the American funnel web spider, Agelenopsis aperta. ω-Aga IVa is a selective and potent blocker of the mammalian P-type voltage-dependent calcium channel. ω-Agatoxin IVA is a potent, selective P/Q type Ca2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels. |
| References | 1. Augmentation treatment of psychotherapy for anxiety disorders with D-cycloserine. S.G.Hofmann et al., CNS Drug Rev., 12, 208 (2006) 2. Sequential assignment and structure determination of spider toxin omega-Aga-IVB. H.Yu et al., Biochemistry, 32, 13123 (1993) 3. A novel type of calcium channel sensitive to omega-agatoxin-TK in cultured rat cerebral cortical neurons. T Teramoto, et al. Brain Res. 1997 May 9;756(1-2):225-30. 4. Involvement of P-type calcium channels in high potassium-elicited release of neurotransmitters from rat brain slices. M Kimura, et al. Neuroscience. 1995 Jun;66(3):609-15. |