PeptideDB

Neuropeptide Y (human, rat)

CAS No.: 90880-35-6

Neuropeptide Y (human, rat) also called NPY (human, rat), is involved in Alzheimer’s disease (AD) and protects rat cort
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 90880-35-6
Sequence H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
Sequence Single YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Molecular Formula C189H285N55O57S
Molecular Weight 4271.74
Synonyms NPY (human, rat)
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Obesity Research|Parkinson’s Disease
Description Neuropeptide Y (human, rat) also called NPY (human, rat), is involved in Alzheimer’s disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.
References 1.  Solid-phase peptide synthesis of human(Nle-27)-oxyntomodulin. Preliminary evaluation of its biological activities M.P.Audousset-Puech et al., FEBS Lett., 200, 181 (1986) 2.  Isolation and sequence of rat peptide YY and neuropeptide Y. R.Corder et al., Regul. Pept., 21, 253 (1988) 3.  Neuropeptide Y protects rat cortical neurons against β-amyloid toxicity and re-establishes synthesis and release of nerve growth factor. Croce N, et al. ACS Chem Neurosci. 2012 Apr 18;3(4):312-8.