| CAS | 90880-35-6 |
| Sequence | H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Sequence Single | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
| Molecular Formula | C189H285N55O57S |
| Molecular Weight | 4271.74 |
| Synonyms | NPY (human, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Obesity Research|Parkinson’s Disease |
| Description | Neuropeptide Y (human, rat) also called NPY (human, rat), is involved in Alzheimer’s disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. |
| References | 1. Solid-phase peptide synthesis of human(Nle-27)-oxyntomodulin. Preliminary evaluation of its biological activities M.P.Audousset-Puech et al., FEBS Lett., 200, 181 (1986) 2. Isolation and sequence of rat peptide YY and neuropeptide Y. R.Corder et al., Regul. Pept., 21, 253 (1988) 3. Neuropeptide Y protects rat cortical neurons against β-amyloid toxicity and re-establishes synthesis and release of nerve growth factor. Croce N, et al. ACS Chem Neurosci. 2012 Apr 18;3(4):312-8. |