| CAS | 99575-89-0 |
| Sequence | H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH |
| Sequence Single | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Molecular Formula | C189H284N54O58S |
| Molecular Weight | 4272.73 |
| Synonyms | NPY (free acid) (human, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Obesity Research |
| Description | Neuropeptide Y (free acid) (human, rat) also called NPY (free acid) (human, rat), is the desamidation of neuropeptide Y, it suppresses almost all of NPY effects. |
| References | 1. Multiple neuropeptide Y receptors regulate K+ and Ca2+ channels in acutely isolated neurons from the rat arcuate nucleus. L.Sun and R.J.Miller, J. Neurophysiol., 81, 1391 (1999) |
Neuropeptide Y (free acid) (human, rat)
CAS No.: 99575-89-0
Neuropeptide Y (free acid) (human, rat) also called NPY (free acid) (human, rat), is the desamidation of neuropeptide Y,
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.