| CAS | 1872440-65-7 |
| Sequence | H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Lys-Glu-Phe-Lys-Ala-NH2 (Disulfide bonds between Cys1 and Cys5/Cys14 and Cys32) |
| Sequence Single | CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH2 |
| Molecular Formula | C205H326N64O61S5 |
| Molecular Weight | 4823.57 |
| Synonyms | PAC1 Receptor Antagonist M65, (Des-Lys38)-PAC1 Receptor Antagonist M65 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Description | M65 also called PAC1 Receptor Antagonist M65, (Des-Lys38)-PAC1 Receptor Antagonist M65, is a potent and specific PAC1 receptor antagonist. |
| References | 1. Peptides as asymmetric catalysts and templates for the controlled formation of Ag nanoparticles. H.Wennemers, J. Pept. Sci., 18, 437 (2012) 2. Functional characterization of structural alterations in the sequence of the vasodilatory peptide maxadilan yields a pituitary adenylate cyclase-activating peptide type 1 receptor-specific antagonist. O.Moro et al., J. Biol. Chem., 274, 23103 (1999) 3. Maxadilan, a PAC1 receptor agonist from sand flies. E.A.Lerner et al., Peptides, 28, 1651 (2007) |