| CAS | 374683-24-6 |
| Sequence | H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 |
| Sequence Single | GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 |
| Molecular Formula | C258H401N79O78 |
| Molecular Weight | 5857.51 |
| Synonyms | Metastin (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (68-121) (human), KiSS-1 (68-121) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cancer Research|Pituitary & Hypothalamic Hormones |
| Description | Kisspeptin-54 (human) also called Metastin (human), Malignant Melanoma Metastasis-Suppressor KiSS-1 (68-121) (human), KiSS-1 (68-121) (human), is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) hinders tumor metastasis and stimulates gonadotropin secretion. It is a key regulator of the hypothalamo-pituitary-gonadal (HPG) axis. |
| References | 1. A highly specific mechanism of histone H3-K4 recognition by histone demethylase LSD1. F.Forneris et al., J. Biol. Chem., 281, 35289 (2006) 2. New gatekeepers of reproduction: GPR54 and its cognate ligand, KiSS-1. S.B.Seminara and U.B.Kaiser, Endocrinology, 146, 1686 (2005) 3. A role for kisspeptins in the regulation of gonadotropin secretion in the mouse. M.L.Gottsch et al., Endocrinology, 145, 4073 (2004) 4. Kisspeptin-54 stimulates gonadotropin release most potently during the preovulatory phase of the menstrual cycle in women. W.S.Dhillo et al., J. Clin. Endocrinol. Metab., 92, 3958 (2007) 5. The Metastasis Suppressor Gene KiSS-1 Encodes Kisspeptins, the Natural Ligands of the Orphan G Protein-Coupled Receptor GPR54. M Kotani, et al. J Biol Chem. 2001 Sep 14;276(37):34631-6. |