Kisspeptin-54 (27-54) (human) Kisspeptin Peptides Catalog

CAS	1135442-77-1
Sequence	H-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
Sequence Single	IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Molecular Formula	C149H226N42O39
Molecular Weight	3229.69
Synonyms	Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human), KiSS-1 (94-121) (human), Metastin (27-54) (human)
Technology	Synthetic
Storage	-20°C, avoid light, cool and dry place
Application	Cancer Research
Description	Kisspeptin-54 (27-54) (human) also called Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human), KiSS-1 (94-121) (human), Metastin (27-54) (human), is an LRF-amide motif containing fragment of malignant melanoma metastasis-suppressor KiSS-1 which binds to human GPR54, a G-protein-coupled receptor also known as AXOR12. It shows lower agonistic potency towards AXOR12 than malignant melanoma metastasis-suppressor Kisspeptin-10.
References	1. Identification of receptors for neuromedin U and its role in feeding. A.D.Howard et al., Nature, 406, 70 (2000) 2. Chromosome localization and genomic structure of the KiSS-1 metastasis suppressor gene (KISS1). A.West et al., Genomics, 54, 145 (1998) 3. AXOR12, a novel human G protein-coupled receptor, activated by the peptide KiSS-1. A.I.Muir et al., J. Biol. Chem., 276, 28969 (2001) 4. Chromosome localization and genomic structure of the KiSS-1 metastasis suppressor gene (KISS1). A.West et al., Genomics, 54, 145 (1998)

PeptideDB