| CAS | 1132745-52-8 |
| Sequence | H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH |
| Sequence Single | RSLQDTEEKSRSFSASQADPLSDPDQMNED |
| Molecular Formula | C136H215N41O58S |
| Molecular Weight | 3384.51 |
| Synonyms | Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | GRPP (human) also known as Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human), is a synthetic analog of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells. |
| References | 1. Oxyntomodulin inhibits food intake in the rat. C.L.Dakin et al., Endocrinology, 142, 4244 (2001) 2. Role of the prohormone convertase PC2 in the processing of proglucagon to glucagon. Y.Rouillé et al., FEBS Lett., 413, 119 (1997) |