PeptideDB

GRPP (human)

CAS No.: 1132745-52-8

GRPP (human) also known as Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (hu
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 1132745-52-8
Sequence H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH
Sequence Single RSLQDTEEKSRSFSASQADPLSDPDQMNED
Molecular Formula C136H215N41O58S
Molecular Weight 3384.51
Synonyms Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human)
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Diabetes
Description GRPP (human) also known as Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human), is a synthetic analog of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells.
References 1.  Oxyntomodulin inhibits food intake in the rat. C.L.Dakin et al., Endocrinology, 142, 4244 (2001) 2.  Role of the prohormone convertase PC2 in the processing of proglucagon to glucagon. Y.Rouillé et al., FEBS Lett., 413, 119 (1997)