| CAS | 74870-06-7 |
| Sequence | H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH |
| Sequence Single | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Molecular Formula | C192H295N59O60S |
| Molecular Weight | 4421.88 |
| Synonyms | Glucagon-37 (bovine, dog, porcine), OXM (bovine, dog, porcine), Preproglucagon (53-89) (bovine, dog, porcine), Proglucagon (33-69) (bovine, dog, porcine) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes|Veterinary Medicine |
| Description | Oxyntomodulin (bovine, dog, porcine) also called Glucagon-37 (bovine, dog, porcine), OXM (bovine, dog, porcine), Preproglucagon (53-89) (bovine, dog, porcine), Proglucagon (33-69) (bovine, dog, porcine), is released from the gut postprandially, in proportion to energy intake. Circulating levels of oxyntomodulin are elevated in several conditions associated with anorexia. Central injection of oxyntomodulin reduces food intake and weight gain in rodents, suggesting that oxyntomodulin signals food ingestion to hypothalamic appetite-regulating circuits. |
Oxyntomodulin (bovine, dog, porcine)
CAS No.: 74870-06-7
Oxyntomodulin (bovine, dog, porcine) also called Glucagon-37 (bovine, dog, porcine), OXM (bovine, dog, porcine), Preprog
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.