| CAS | 1802086-27-6 |
| Sequence | H-Tyr-Leu-Gly-Ala-Ser-Val-Pro-Ser-Pro-Asp-Pro-Leu-Glu-Pro-Thr-Arg-Glu-Gln-Cys-Glu-Leu-Asn-Pro-Ala-Cys-Asp-Glu-Leu-Ser-Asp-Gln-Tyr-Gly-Leu-Lys-Thr-Ala-Tyr-Lys-Arg-Ile-Tyr-Gly-Ile-Thr-Ile-OH (Disulfide bond) |
| Sequence Single | YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI |
| Molecular Formula | C226H351N57O74S2 |
| Molecular Weight | 5114.75 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes|Obesity Research|Osteoporosis Research |
| Description | (Glu13.17.20)-Osteocalcin (1-46) (mouse) is a non-carboxylated osteocalcin, it was shown to be a bone-specific hormone involved in the regulation of glucose metabolism, for which the Gla peptide acts as precursor and transport form. |
| References | 1. Bradykinin modulation of tumor vasculature: II. activation of nitric oxide and phospholipase A2/prostaglandin signaling pathways synergistically modifies vascular physiology and morphology to enhance delivery of chemotherapeutic agents to tumors. D.F.Emerich et al., J. Pharmacol. Exp. Ther., 296, 632 (2001) |
(Glu13.17.20)-Osteocalcin (1-46) (mouse)
CAS No.: 1802086-27-6
(Glu13.17.20)-Osteocalcin (1-46) (mouse) is a non-carboxylated osteocalcin, it was shown to be a bone-specific hormone i
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.