| CAS | 223460-79-5 |
| Sequence | H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH |
| Sequence Single | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Molecular Formula | C165H254N44O55S |
| Molecular Weight | 3766.16 |
| Synonyms | Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | GLP-2 (1-33) also called Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human), is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. Like GLP-1, GLP-2 is secreted from enteroendocrine cells in a nutrient-dependent manner in both rodents and humans. Currently GLP-2 is used as a potential therapeutic agent for human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency. |
| References | 1. Identification of a neuropeptide hormone that regulates sex pheromone production in female moths. A.K.Raina et al., Science, 244, 796 (1989) 2. Peripheral administration of GLP-2 to humans has no effect on gastric emptying or satiety. P.T.Schmidt et al., Regul. Pept., 116, 21 (2003) 3. The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways. J.A.Koehler et al., Mol. Endocrinol., 19, 459 (2005) 4. Biologic properties and therapeutic potential of glucagon-like peptide-2. D.J.Drucker et al., J. Parenter. Enteral Nutr., 23, S98 (1999) 5. Glucagon-like Peptide 2. D.J.Drucker, Trends Endocrinol. Metab., 10, 153 (1999) 6. Gut adaptation and the glucagon-like peptides. D.J.Drucker, Gut, 50, 428 (2002) |