PeptideDB

GLP-2 (1-33) (human)

CAS No.: 223460-79-5

GLP-2 (1-33) also called Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 223460-79-5
Sequence H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence Single HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Molecular Formula C165H254N44O55S
Molecular Weight 3766.16
Synonyms Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human)
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Diabetes
Description GLP-2 (1-33) also called Glucagon-Like Peptide 2 (human), Preproglucagon (146-178) (human), Proglucagon (126-158) (human), is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. Like GLP-1, GLP-2 is secreted from enteroendocrine cells in a nutrient-dependent manner in both rodents and humans. Currently GLP-2 is used as a potential therapeutic agent for human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.
References 1.  Identification of a neuropeptide hormone that regulates sex pheromone production in female moths. A.K.Raina et al., Science, 244, 796 (1989) 2.  Peripheral administration of GLP-2 to humans has no effect on gastric emptying or satiety. P.T.Schmidt et al., Regul. Pept., 116, 21 (2003) 3.  The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways. J.A.Koehler et al., Mol. Endocrinol., 19, 459 (2005) 4.  Biologic properties and therapeutic potential of glucagon-like peptide-2. D.J.Drucker et al., J. Parenter. Enteral Nutr., 23, S98 (1999) 5.  Glucagon-like Peptide 2. D.J.Drucker, Trends Endocrinol. Metab., 10, 153 (1999) 6.  Gut adaptation and the glucagon-like peptides. D.J.Drucker, Gut, 50, 428 (2002)