PeptideDB

GLP-2 (rat)

CAS No.: 195262-56-7

GLP-2 (rat) also called Glucagon-Like Peptide 2 (rat), Preproglucagon (146-178) (rat), Proglucagon (126-158) (rat), Gluc
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

CAS 195262-56-7
Sequence H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
Sequence Single HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Molecular Formula C166H256N44O56S
Molecular Weight 3796.19
Synonyms Glucagon-Like Peptide 2 (rat), Preproglucagon (146-178) (rat), Proglucagon (126-158) (rat), Glucagon-Like Peptide II, rat
Technology Synthetic
Storage -20°C, avoid light, cool and dry place
Application Apoptosis & Necrosis|Diabetes
Description GLP-2 (rat) also called Glucagon-Like Peptide 2 (rat), Preproglucagon (146-178) (rat), Proglucagon (126-158) (rat), Glucagon-Like Peptide II, rat, is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
References 1.  Biological actions and therapeutic potential of the glucagon-like peptides. D.J.Drucker, Gastroenterology, 122, 531 (2002)