| CAS | 195262-56-7 |
| Sequence | H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH |
| Sequence Single | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Molecular Formula | C166H256N44O56S |
| Molecular Weight | 3796.19 |
| Synonyms | Glucagon-Like Peptide 2 (rat), Preproglucagon (146-178) (rat), Proglucagon (126-158) (rat), Glucagon-Like Peptide II, rat |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Apoptosis & Necrosis|Diabetes |
| Description | GLP-2 (rat) also called Glucagon-Like Peptide 2 (rat), Preproglucagon (146-178) (rat), Proglucagon (126-158) (rat), Glucagon-Like Peptide II, rat, is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). |
| References | 1. Biological actions and therapeutic potential of the glucagon-like peptides. D.J.Drucker, Gastroenterology, 122, 531 (2002) |