| CAS | 161748-29-4 |
| Sequence | H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Sequence Single | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Molecular Formula | C140H214N36O43 |
| Molecular Weight | 3089.46 |
| Synonyms | Glucagon-Like Peptide 1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat), Preproglucagon (100-127) amide (human, bovine, guinea pig, mouse, porcine, rat), Proglucagon (80-107) amide (human, bovine, guinea pig, mouse, porcine, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | GLP-1 (9-36) amide also called Glucagon-Like Peptide 1 (9-36) amide, Preproglucagon (100-127) amide, Proglucagon (80-107) amide. Glucagon-like peptide-1 (GLP-1) is efficiently degraded by the enzyme dipeptidyl peptidase IV (DPP IV), yielding the major metabolite GLP-1 (9-36) amide. GLP-1 (9-36) amide does not affect glucose disposal in mice either in the presence or absence of intact GLP-1 receptors or in the presence or absence of stimulated insulin levels. This suggests that the GLP-1 metabolite is not involved in the regulation of glucose homeostasis. Elahi et al. have shown that this GLP-1 metabolite acts as a weak insulinotropic agent and inhibits hepatic glucose production. |
| References | 1. Differential activation of endopeptidase EC 3.4.24.15 toward natural and synthetic substrates by metal ions. A.J.Wolfson et al., Biochem. Biophys. Res. Commun., 229, 341 (1996) 2. The major glucagon-like peptide-1 metabolite, GLP-1-(9-36)-amide, does not affect glucose or insulin levels in mice. B.Rolin et al., Eur. J. Pharmacol., 494, 283 (2004) 3. Inhibition of dipeptidyl peptidase IV improves metabolic control over a 4-week study period in type 2 diabetes. B.Ahrén et al., Diabetes Care, 25, 869 (2002) 4. GLP-1 (9-36) amide, cleavage product of GLP-1 (7-36) amide, is a glucoregulatory peptide. D.Elahi et al., Obesity, 16, 1501 (2008) |
GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat)
CAS No.: 161748-29-4
GLP-1 (9-36) amide also called Glucagon-Like Peptide 1 (9-36) amide, Preproglucagon (100-127) amide, Proglucagon (80-107
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.