| CAS | 106612-94-6 |
| Sequence | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
| Sequence Single | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Molecular Formula | C151H228N40O47 |
| Molecular Weight | 3355.71 |
| Synonyms | Insulinotropin , Glucagon-Like Peptide 1 (7-37), Preproglucagon (98-128), Proglucagon (78-108) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | GLP-1(7-37) also called Insulinotropin , Glucagon-Like Peptide 1 (7-37), Preproglucagon (98-128), Proglucagon (78-108) , is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. |
| References | 1. Design, synthesis, and biological properties of highly potent cyclic dynorphin A analogues. Analogues cyclized between positions 5 and 11. J.P.Meyer et al., J. Med. Chem., 37, 3910 (1994) 2. Singular contributions of fish neuroendocrinology to mammalian regulatory peptide research. J.M.Conlon, Regul. Pept., 93, 3 (2000) 3. Amidated and non-amidated glucagon-like peptide-1 (GLP-1): non-pancreatic effects (cephalic phase acid secretion) and stability in plasma in humans. A.Wettergren et al., Regul. Pept., 77, 83 (1998) 4. Gut adaptation and the glucagon-like peptides. D.J.Drucker, Gut, 50, 428 (2002) 5. Biological actions and therapeutic potential of the glucagon-like peptides. D.J.Drucker, Gastroenterology, 122, 531 (2002) 6. Proglucagon processing profile in canine L cells expressing endogenous prohormone convertase 1/3 and prohormone convertase 2. A.B.Damholt et al., Endocrinology, 140, 4800 (1999) |
GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)
CAS No.: 106612-94-6
GLP-1(7-37) also called Insulinotropin , Glucagon-Like Peptide 1 (7-37), Preproglucagon (98-128), Proglucagon (78-108) ,
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.