| CAS | 215777-46-1 |
| Sequence | H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Sequence Single | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Molecular Formula | C149H226N40O46 |
| Molecular Weight | 3313.68 |
| Synonyms | (Ser8)-Glucagon-Like Peptide 1 (7-36) amide (human, bovine, guinea pig, mouse, rat), (Ser79)-Proglucagon (78-107) amide (human, bovine, guinea pig, mouse, rat), (Ser99)-Preproglucagon (98-127) amide (human, bovine, guinea pig, mouse, rat) |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Diabetes |
| Description | (Ser8)-GLP-1 (7-36) amide also called (Ser8)-Glucagon-Like Peptide 1 (7-36) amide. The replacement of alanine by serine significantly improved the plasma stability of GLP-1 (7-36) amide against DPP IV without impairing its insulinotropic activity. This may indicate that this modification could improve the potential of GLP-1 in the treatment of type-II diabetes. |
| References | 1. An asparaginyl endopeptidase processes a microbial antigen for class II MHC presentation. B.Manoury et al., Nature, 396, 695 (1998) |
(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)
CAS No.: 215777-46-1
(Ser8)-GLP-1 (7-36) amide also called (Ser8)-Glucagon-Like Peptide 1 (7-36) amide. The replacement of alanine by serine
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.