| CAS | 78362-34-2 |
| Sequence | H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH |
| Sequence Single | ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
| Molecular Formula | C177H279N49O58 |
| Molecular Weight | 4021.46 |
| Technology | Synthetic |
| Storage | -20°C, avoid light, cool and dry place |
| Application | Cardiovascular System & Diseases |
| Description | Copeptin (human) has emerged as a prognostic marker in a variety of diseases, such as sepsis, community-acquired pneumonia, chronic obstructive pulmonary failure, heart failure and myocardial infarction. Copeptin (CT-proAVP) is initially produced in equimolar amounts to (Arg8)-Vasopressin (AVP). Due to the high stability of copeptin in plasma and serum its measurement is not affected by the problems, which are associated with the direct measurement of AVP, and thus, is suitable to indirectly determine the release of AVP. |
| References | 1. Osmotically induced synthesis of the dipeptide N-acetylglutaminylglutamine amide is mediated by a new pathway conserved among bacteria. B.Sagot et al., Proc. Natl. Acad. Sci. USA, 107, 12652 (2010) 2. Copeptin, a novel prognostic biomarker in ventilator-associated pneumonia. R.Seligman et al., Crit. Care, 12, R11 (2008) 3. Changes in plasma copeptin, the c-terminal portion of arginine vasopressin during water deprivation and excess in healthy subjects. G.Szinnai et al., J. Clin. Endocrinol. Metab., 92, 3973 (2007) 4. Copeptin, a stable peptide derived from the vasopressin precursor, is elevated in serum of sepsis patients. J.Struck et al., Peptides, 26, 2500 (2005) 5. Assay for the measurement of copeptin, a stable peptide derived from the precursor of vasopressin. N.G.Morgenthaler et al., Clin. Chem., 52, 112 (2006) 6. Copeptin: a new and promising diagnostic and prognostic marker. M.Katan et al., Crit. Care, 12, 117 (2008) |